TTC9C antibody (N-Term)

Catalog No. ABIN631689

Product Details anti-TTC9C Antibody

Target: TTC9C (Tetratricopeptide Repeat Domain 9C (TTC9C))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TTC9C antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TTC9 C antibody was raised against the N terminal of TTC9

Purification: Affinity purified

Immunogen: TTC9 C antibody was raised using the N terminal of TTC9 corresponding to a region with amino acids MEKRLQEAQLYKEEGNQRYREGKYRDAVSRYHRALLQLRGLDPSLPSPLP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TTC9C Blocking Peptide, catalog no. 33R-5931, is also available for use as a blocking control in assays to test for specificity of this TTC9C antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TTC0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TTC9C

Target: TTC9C (Tetratricopeptide Repeat Domain 9C (TTC9C))

Alternative Name: TTC9C (TTC9C Products)

Synonyms: MGC56497 antibody, zgc:56497 antibody, im:7142077 antibody, 2210019E14Rik antibody, 6330408J23Rik antibody, RGD1359253 antibody, tetratricopeptide repeat domain 9C antibody, ttc9c antibody, TTC9C antibody, Ttc9c antibody

Background: The function of TTC9C protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 20 kDa (MW of target protein)