GNB1 antibody
-
- Target See all GNB1 Antibodies
- GNB1 (Guanine Nucleotide Binding Protein (G Protein), beta Polypeptide 1 (GNB1))
-
Reactivity
- Human, Mouse, Rat, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This GNB1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- GNB1 antibody was raised using a synthetic peptide corresponding to a region with amino acids DLRADQELMTYSHDNIICGITSVSFSKSGRLLLAGYDDFNCNVWDALKAD
- Top Product
- Discover our top product GNB1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
GNB1 Blocking Peptide, catalog no. 33R-2064, is also available for use as a blocking control in assays to test for specificity of this GNB1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GNB1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GNB1 (Guanine Nucleotide Binding Protein (G Protein), beta Polypeptide 1 (GNB1))
- Alternative Name
- GNB1 (GNB1 Products)
- Background
- Heterotrimeric guanine nucleotide-binding proteins (G proteins), which integrate signals between receptors and effector proteins, are composed of an alpha, a beta, and a gamma subunit. These subunits are encoded by families of related genes. GNB1 is a beta subunit. Beta subunits are important regulators of alpha subunits, as well as of certain signal transduction receptors and effectors.Heterotrimeric guanine nucleotide-binding proteins (G proteins), which integrate signals between receptors and effector proteins, are composed of an alpha, a beta, and a gamma subunit.
- Molecular Weight
- 37 kDa (MW of target protein)
- Pathways
- Myometrial Relaxation and Contraction, Regulation of G-Protein Coupled Receptor Protein Signaling, CXCR4-mediated Signaling Events, Phototransduction, Thromboxane A2 Receptor Signaling, SARS-CoV-2 Protein Interactome
-