NME4 antibody (Middle Region)
-
- Target See all NME4 Antibodies
- NME4 (NME/NM23 Nucleoside Diphosphate Kinase 4 (NME4))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This NME4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- NME4 antibody was raised against the middle region of NME4
- Purification
- Affinity purified
- Immunogen
- NME4 antibody was raised using the middle region of NME4 corresponding to a region with amino acids VAMVWEGYNVVRASRAMIGHTDSAEAAPGTIRGDFSVHISRNVIHASDSV
- Top Product
- Discover our top product NME4 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
NME4 Blocking Peptide, catalog no. 33R-9429, is also available for use as a blocking control in assays to test for specificity of this NME4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NME4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NME4 (NME/NM23 Nucleoside Diphosphate Kinase 4 (NME4))
- Alternative Name
- NME4 (NME4 Products)
- Synonyms
- NDPK-D antibody, NM23H4 antibody, nm23-H4 antibody, 2610027N22Rik antibody, 2810024O08Rik antibody, 5730493H09Rik antibody, NM23-M4 antibody, Nm23M4 antibody, NME/NM23 nucleoside diphosphate kinase 4 antibody, NME4 antibody, Nme4 antibody
- Background
- The nucleoside diphosphate (NDP) kinases (EC 2.7.4.6) are ubiquitous enzymes that catalyze transfer of gamma-phosphates, via a phosphohistidine intermediate, between nucleoside and dioxynucleoside tri- and diphosphates.
- Molecular Weight
- 21 kDa (MW of target protein)
- Pathways
- Nucleotide Phosphorylation, Ribonucleoside Biosynthetic Process
-