GPD1 antibody
-
- Target See all GPD1 Antibodies
- GPD1 (Glycerol-3-Phosphate Dehydrogenase 1 (Soluble) (GPD1))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This GPD1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- GPD1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TFLESCGVADLITTCYGGRNRKVAEAFARTGKSIEQLEKELLNGQKLQGP
- Top Product
- Discover our top product GPD1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
GPD1 Blocking Peptide, catalog no. 33R-9068, is also available for use as a blocking control in assays to test for specificity of this GPD1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GPD1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GPD1 (Glycerol-3-Phosphate Dehydrogenase 1 (Soluble) (GPD1))
- Alternative Name
- GPD1 (GPD1 Products)
- Synonyms
- GPDH antibody, Gpd3 antibody, GPD-C antibody, GPDH-C antibody, HTGTI antibody, CG9042 antibody, DROGPDHA antibody, DmG3PDH antibody, Dmel\\CG9042 antibody, G3PDH antibody, G3pdh antibody, GAPDH antibody, GPD antibody, GPDA antibody, GPDH-1 antibody, Gdh antibody, Gpd antibody, alpha-GPD antibody, alpha-GPDH antibody, alpha-GPDH-1 antibody, alpha-Gpdh antibody, alphaGPDH antibody, alphaGpd antibody, alphaGpdh antibody, alphaGpdh-1 antibody, gpdh antibody, gpdh-1 antibody, sn-Gpdh antibody, AI747587 antibody, Gdc-1 antibody, Gdc1 antibody, mKIAA4010 antibody, gpd1 antibody, wu:fc30a07 antibody, zgc:63859 antibody, MGC79676 antibody, GPD1 antibody, LG3P antibody, zgc:112197 antibody, Gpd1 antibody, gpd1h antibody, gpd1l antibody, wu:fc58b05 antibody, zgc:66051 antibody, zgc:85742 antibody, glycerol-3-phosphate dehydrogenase 1 antibody, Glycerol-3-phosphate dehydrogenase [NAD(+)] antibody, glycerol-3-phosphate dehydrogenase antibody, Glycerol 3 phosphate dehydrogenase antibody, glycerol-3-phosphate dehydrogenase 1 (soluble) antibody, glycerol-3-phosphate dehydrogenase 1 L homeolog antibody, glycerol-3-phosphate dehydrogenase 1c antibody, glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic antibody, glycerol-3-phosphate dehydrogenase 1a antibody, glycerol-3-phosphate dehydrogenase 1b antibody, Gpd1 antibody, gpdh-1 antibody, GPD1 antibody, Tb11.02.5280 antibody, Gpdh antibody, gpd1.L antibody, gpd1c antibody, gpd1 antibody, LOC101071719 antibody, gpd1a antibody, gpd1b antibody
- Background
- GPD1L belongs to the NAD-dependent glycerol-3-phosphate dehydrogenase family. Defects in GPD1L are the cause of Brugada syndrome type 2 (BRS2) and sudden infant death syndrome (SIDS).
- Molecular Weight
- 37 kDa (MW of target protein)
-