CAD antibody (Middle Region)
-
- Target See all CAD Antibodies
- CAD (Carbamoyl-Phosphate Synthetase 2, Aspartate Transcarbamylase, and Dihydroorotase (CAD))
-
Binding Specificity
- Middle Region
-
Reactivity
- Drosophila melanogaster
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CAD antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CAD antibody was raised against the middle region of CAD
- Purification
- Affinity purified
- Immunogen
- CAD antibody was raised using the middle region of CAD corresponding to a region with amino acids SVSNNNRTSPSKPPYFDWMKKPAYPAQPQPGKTRTKDKYRVVYTDFQRLE
- Top Product
- Discover our top product CAD Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CAD Blocking Peptide, catalog no. 33R-8934, is also available for use as a blocking control in assays to test for specificity of this CAD antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CAD antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CAD (Carbamoyl-Phosphate Synthetase 2, Aspartate Transcarbamylase, and Dihydroorotase (CAD))
- Alternative Name
- CAD (CAD Products)
- Synonyms
- Cpad antibody, AU018859 antibody, 2410008J01Rik antibody, cb456 antibody, wu:fc30c12 antibody, wu:fc33d01 antibody, wu:fc67g02 antibody, si:dkey-221h15.3 antibody, CAD antibody, xcad antibody, carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase antibody, CAD antibody, Cad antibody, cad antibody
- Background
- Cad regulates embryonic abdominal segment formation by zygotically activating expression of knirps (kni) and giant (gt). It plays a role in the establishment of the hindgut and in the invagination of the hindgut primordium during gastrulation. These effects on the gut are achieved by acting combinatorially at the posterior of the embryo to activate transcription of different targets, including folded gastrulation (fog), fork head (fkh) and wingless (wg).
- Molecular Weight
- 46 kDa (MW of target protein)
- Pathways
- Production of Molecular Mediator of Immune Response, Ribonucleoside Biosynthetic Process
-