APOH antibody

Catalog No. ABIN631792

Product Details anti-APOH Antibody

Target: APOH (Apolipoprotein H (Beta-2-Glycoprotein I) (APOH))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This APOH antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: ApoH antibody was raised using a synthetic peptide corresponding to a region with amino acids PPPSIPTFATLRVYKPSAGNNSLYRDTAVFECLPQHAMFGNDTITCTTHG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ApoH Blocking Peptide, catalog no. 33R-7270, is also available for use as a blocking control in assays to test for specificity of this ApoH antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of APOH antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for APOH

Target: APOH (Apolipoprotein H (Beta-2-Glycoprotein I) (APOH))

Alternative Name: ApoH (APOH Products)

Synonyms: B2G1 antibody, B2GP1 antibody, BG antibody, BETA2 antibody, BHF-1 antibody, MODY6 antibody, NEUROD antibody, bHLHa3 antibody, apoh antibody, APOH antibody, B2GPI antibody, beta-2-GPI antibody, beta2-GPI antibody, LOC100227913 antibody, apolipoprotein H antibody, neuronal differentiation 1 antibody, APOH antibody, NEUROD1 antibody, apoh antibody, Apoh antibody

Background: Apolipoprotein H has been implicated in a variety of physiologic pathways including lipoprotein metabolism, coagulation, and the production of antiphospholipid autoantibodies.

Molecular Weight: 36 kDa (MW of target protein)