AXUD1 antibody (Middle Region)

Catalog No. ABIN631806

Product Details anti-AXUD1 Antibody

Target: AXUD1 (CSRNP1) (Cysteine-serine-Rich Nuclear Protein 1 (CSRNP1))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This AXUD1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: AXUD1 antibody was raised against the middle region of AXUD1

Purification: Affinity purified

Immunogen: AXUD1 antibody was raised using the middle region of AXUD1 corresponding to a region with amino acids ARVQTHFIHTLTRLQLEQEAESFRELEAPAQGSPPSPGEEALVPTFPLAK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

AXUD1 Blocking Peptide, catalog no. 33R-1498, is also available for use as a blocking control in assays to test for specificity of this AXUD1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AXUD1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for AXUD1

Target: AXUD1 (CSRNP1) (Cysteine-serine-Rich Nuclear Protein 1 (CSRNP1))

Alternative Name: AXUD1 (CSRNP1 Products)

Synonyms: AXUD1 antibody, CSRNP-1 antibody, FAM130B antibody, TAIP-3 antibody, URAX1 antibody, 4931429D10Rik antibody, Axud1 antibody, taip-3 antibody, CSRNP1 antibody, axud1 antibody, MGC145297 antibody, fb73e11 antibody, wu:fb73e11 antibody, zgc:66340 antibody, cysteine and serine rich nuclear protein 1 antibody, cysteine-serine-rich nuclear protein 1 antibody, cysteine-serine-rich nuclear protein 1 L homeolog antibody, cysteine-serine-rich nuclear protein 1b antibody, CSRNP1 antibody, Csrnp1 antibody, csrnp1 antibody, csrnp1.L antibody, csrnp1b antibody

Background: This gene encodes a protein that localizes to the nucleus and expression of this gene is induced in response to elevated levels of axin. The Wnt signalling pathway, which is negatively regulated by axin, is important in axis formation in early development and impaired regulation of this signalling pathway is often involved in tumors. A decreased level of expression of this gene in tumors compared to the level of expression in their corresponding normal tissues suggests that this gene product has a tumor suppressor function.

Molecular Weight: 63 kDa (MW of target protein)

Pathways: Platelet-derived growth Factor Receptor Signaling