ALOX12 antibody (C-Term)

Catalog No. ABIN631808

Product Details anti-ALOX12 Antibody

Target: ALOX12 (Arachidonate 12-Lipoxygenase (ALOX12))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ALOX12 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ALOX12 antibody was raised against the C terminal of ALOX12

Purification: Affinity purified

Immunogen: ALOX12 antibody was raised using the C terminal of ALOX12 corresponding to a region with amino acids MGSLPDVRQACLQMAISWHLSRRQPDMVPLGHHKEKYFSGPKPKAVLNQF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ALOX12 Blocking Peptide, catalog no. 33R-6077, is also available for use as a blocking control in assays to test for specificity of this ALOX12 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALOX12 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ALOX12

Target: ALOX12 (Arachidonate 12-Lipoxygenase (ALOX12))

Alternative Name: ALOX12 (ALOX12 Products)

Synonyms: 15-LOX-1 antibody, 15LOX-1 antibody, 12-LOX antibody, 12S-LOX antibody, LOG12 antibody, ALOX12 antibody, ALOX15 antibody, 9930022G08Rik antibody, Alox12p antibody, P-12LO antibody, 12-LO antibody, zgc:64120 antibody, wu:fb72a11 antibody, arachidonate 15-lipoxygenase antibody, arachidonate 12-lipoxygenase, 12S type antibody, arachidonate 12-lipoxygenase antibody, arachidonate 12-lipoxygenase, 12S-type antibody, ALOX15 antibody, ALOX12 antibody, Alox12 antibody, alox12 antibody, LOC100072916 antibody

Background: ALOX12 belongs to the lipoxygenase family. It contains 1 lipoxygenase domain and 1 PLAT domain. It has oxygenase and 14,15-leukotriene A4 synthase activity.

Molecular Weight: 76 kDa (MW of target protein)

Pathways: Positive Regulation of Endopeptidase Activity