FBXW8 antibody (Middle Region)

Catalog No. ABIN631825

Product Details anti-FBXW8 Antibody

Target: FBXW8 (F-Box and WD Repeat Domain Containing 8 (FBXW8))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FBXW8 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: FBXW8 antibody was raised against the middle region of FBXW8

Purification: Affinity purified

Immunogen: FBXW8 antibody was raised using the middle region of FBXW8 corresponding to a region with amino acids MNQKLWEVYSGHPVQHISFSSHSLITANVPYQTVMRNADLDSFTTHRRHR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FBXW8 Blocking Peptide, catalog no. 33R-6260, is also available for use as a blocking control in assays to test for specificity of this FBXW8 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXW8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FBXW8

Target: FBXW8 (F-Box and WD Repeat Domain Containing 8 (FBXW8))

Alternative Name: FBXW8 (FBXW8 Products)

Synonyms: FBW6 antibody, FBW8 antibody, FBX29 antibody, FBXO29 antibody, FBXW6 antibody, 4930438M06Rik antibody, Fbx29 antibody, F-box and WD repeat domain containing 8 antibody, ring finger protein, transmembrane 2 antibody, F-box and WD-40 domain protein 8 antibody, FBXW8 antibody, Fbxw8 antibody, RNFT2 antibody

Background: FBXW8 is a member of the F-box protein family, members of which are characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into three classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. FBXW8 contains a WD-40 domain, in addition to an F-box motif, so it belongs to the Fbw class.

Molecular Weight: 67 kDa (MW of target protein)