GCOM1 antibody (Middle Region)
-
- Target See all GCOM1 Antibodies
- GCOM1 (GRINL1A Complex Locus (GCOM1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This GCOM1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- GCOM1 antibody was raised against the middle region of Gcom1
- Purification
- Affinity purified
- Immunogen
- GCOM1 antibody was raised using the middle region of Gcom1 corresponding to a region with amino acids VAQVENQLLKMKVESSQEANAEVMREMTKKLYSQYEEKLQEEQRKHSAEK
- Top Product
- Discover our top product GCOM1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
GCOM1 Blocking Peptide, catalog no. 33R-9433, is also available for use as a blocking control in assays to test for specificity of this GCOM1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GCOM1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GCOM1 (GRINL1A Complex Locus (GCOM1))
- Alternative Name
- GCOM1 (GCOM1 Products)
- Background
- This gene (Gcom1) is part of a complex transcript unit that includes the gene for glutamate receptor, ionotropic, N-methyl D-aspartate-like 1A (GRINL1A). Transcription of this gene occurs at an upstream promoter, with two different groups of alternatively spliced variants: Gup for GRINL1A upstream transcripts and Gcom for GRINL1A combined transcripts. The GRINL1A gene uses a downstream promoter for transcription and also has multiple alternatively spliced variants.
- Molecular Weight
- 52 kDa (MW of target protein)
-