ACTRT1 antibody (Middle Region)

Catalog No. ABIN631864

Product Details anti-ACTRT1 Antibody

Target: ACTRT1 (Actin-Related Protein T1 (ACTRT1))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ACTRT1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ACTRT1 antibody was raised against the middle region of ACTRT1

Purification: Affinity purified

Immunogen: ACTRT1 antibody was raised using the middle region of ACTRT1 corresponding to a region with amino acids DTDIQNKLYADIVLSGGTTLLPGLEERLMKEVEQLASKGTPIKITASPDR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ACTRT1 Blocking Peptide, catalog no. 33R-2190, is also available for use as a blocking control in assays to test for specificity of this ACTRT1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACTRT1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ACTRT1

Target: ACTRT1 (Actin-Related Protein T1 (ACTRT1))

Alternative Name: ACTRT1 (ACTRT1 Products)

Synonyms: 1700061J02Rik antibody, Arp-T1 antibody, AIP1 antibody, ARIP1 antibody, ARPT1 antibody, HSD27 antibody, ACTRT1 antibody, actin-related protein T1 antibody, actin related protein T1 antibody, Actrt1 antibody, ACTRT1 antibody, LOC539271 antibody, LOC100344945 antibody, LOC100455523 antibody, LOC100472383 antibody, LOC100154405 antibody

Background: The specific function of ACTRT1 is not yet known.

Molecular Weight: 42 kDa (MW of target protein)