RPESP antibody (C-Term)

Catalog No. ABIN631879

Product Details anti-RPESP Antibody

Target: RPESP (C8orf84) (Chromosome 8 Open Reading Frame 84 (C8orf84))

Binding Specificity: C-Term

Reactivity: Mouse, Rat, Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RPESP antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RPESP antibody was raised against the C terminal of RPESP

Purification: Affinity purified

Immunogen: RPESP antibody was raised using the C terminal of RPESP corresponding to a region with amino acids WMQYLREGYTVCVDCQPPAMNSVSLRCSGDGLDSDGNQTLHWQAIGNPRC

Application Details

Application Notes: WB: 2 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RPESP Blocking Peptide, catalog no. 33R-9981, is also available for use as a blocking control in assays to test for specificity of this RPESP antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPESP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RPESP

Target: RPESP (C8orf84) (Chromosome 8 Open Reading Frame 84 (C8orf84))

Alternative Name: RPESP (C8orf84 Products)

Synonyms: C8orf84 antibody, RPESP antibody, C14H8orf84 antibody, Gm106 antibody, Rpesp antibody, RGD1559717 antibody, RPE-spondin antibody, somatomedin B and thrombospondin type 1 domain containing antibody, somatomedin B and thrombospondin, type 1 domain containing antibody, Tsp_04711 antibody, SBSPON antibody, Sbspon antibody

Background: RPESP belongs to the thrombospondin family. It contains 1 SMB (somatomedin-B) domain and 1 TSP type-1 domain. The exact function of RPESP remains unknown.

Molecular Weight: 29 kDa (MW of target protein)