PAD4 antibody (Middle Region)

Catalog No. ABIN631895

Product Details anti-PAD4 Antibody

Target: PAD4 (PADI4) (Peptidyl Arginine Deiminase, Type IV (PADI4))

Binding Specificity: Middle Region

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PAD4 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PADI4 antibody was raised against the middle region of PADI4

Purification: Affinity purified

Immunogen: PADI4 antibody was raised using the middle region of PADI4 corresponding to a region with amino acids TGGISGLDSFGNLEVSPPVTVRGKEYPLGRILFGDSCYPSNDSRQMHQAL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PADI4 Blocking Peptide, catalog no. 33R-9085, is also available for use as a blocking control in assays to test for specificity of this PADI4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PADI4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PAD4

Target: PAD4 (PADI4) (Peptidyl Arginine Deiminase, Type IV (PADI4))

Alternative Name: PADI4 (PADI4 Products)

Synonyms: PAD antibody, PAD4 antibody, PADI5 antibody, PDI4 antibody, PDI5 antibody, Pad4 antibody, Pdi4 antibody, peptidyl arginine deiminase 4 antibody, peptidyl arginine deiminase, type IV antibody, PADI4 antibody, Padi4 antibody

Background: PADI4 is an enzyme responsible for the conversion of arginine residues to citrulline residues. This protein may play a role in granulocyte and macrophage development leading to inflammation and immune response.

Molecular Weight: 74 kDa (MW of target protein)