EARS2 antibody

Catalog No. ABIN631902

Product Details anti-EARS2 Antibody

Target: EARS2 (Glutamyl-tRNA Synthetase 2 Mitochondrial (EARS2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This EARS2 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: EARS2 antibody was raised using a synthetic peptide corresponding to a region with amino acids TAKHLLLYQALGWQPPHFAHLPLLLNRDGSKLSKRQGDVFLEHFAADGFL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

EARS2 Blocking Peptide, catalog no. 33R-8975, is also available for use as a blocking control in assays to test for specificity of this EARS2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EARS2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for EARS2

Target: EARS2 (Glutamyl-tRNA Synthetase 2 Mitochondrial (EARS2))

Alternative Name: EARS2 (EARS2 Products)

Synonyms: mse1 antibody, 3230401I01Rik antibody, AL024049 antibody, mKIAA1970 antibody, COXPD12 antibody, MSE1 antibody, RGD1307904 antibody, ears2 antibody, glutamyl-tRNA synthetase 2, mitochondrial antibody, zgc:153247 antibody, EARS2 antibody, ears2 antibody, Ears2 antibody, zgc:153247 antibody

Background: EARS2 belongs to the class-I aminoacyl-tRNA synthetase family. The function of the EARS2 protein is not known.

Molecular Weight: 59 kDa (MW of target protein)