GBL antibody

Catalog No. ABIN631915

Product Details anti-GBL Antibody

Target: GBL (G protein beta subunit-like (GBL))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GBL antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: GBL antibody was raised using a synthetic peptide corresponding to a region with amino acids CAFSGDSQYIVTASSDNLARLWCVETGEIKREYGGHQKAVVCLAFNDSVL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GBL Blocking Peptide, catalog no. 33R-1639, is also available for use as a blocking control in assays to test for specificity of this GBL antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GBL antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GBL

Target: GBL (G protein beta subunit-like (GBL))

Alternative Name: GBL (GBL Products)

Synonyms: gbl antibody, lts8 antibody, GBL antibody, GbetaL antibody, LST8 antibody, POP3 antibody, WAT1 antibody, 0610033N12Rik antibody, AA409454 antibody, AI505104 antibody, AI851821 antibody, Gbl antibody, fi37e04 antibody, wu:fi37e04 antibody, zgc:55455 antibody, zgc:85668 antibody, MTOR associated protein, LST8 homolog L homeolog antibody, MTOR associated protein, LST8 homolog antibody, MTOR associated protein, LST8 homolog (S. cerevisiae) antibody, mlst8.L antibody, MLST8 antibody, Mlst8 antibody, mlst8 antibody

Background: GBL is the subunit of both mTORC1 and mTORC2, which regulate cell growth and survival in response to nutrient and hormonal signals. mTORC1 is activated in response to growth factors or amino-acids. Activated mTORC1 up-regulates protein synthesis by phosphorylating key regulators of mRNA translation and ribosome synthesis. mTORC2 seems to function upstream of Rho GTPases to regulate the actin cytoskeleton, probably by activating one or more Rho-type guanine nucleotide exchange factors. mTORC2 promotes the serum-induced formation of stress-fibers or F-actin.

Molecular Weight: 36 kDa (MW of target protein)

Pathways: PI3K-Akt Signaling, RTK Signaling, Fc-epsilon Receptor Signaling Pathway, EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Regulation of Actin Filament Polymerization, Autophagy, CXCR4-mediated Signaling Events, BCR Signaling, Warburg Effect