HMBS antibody (N-Term)

Catalog No. ABIN631916

Product Details anti-HMBS Antibody

Target: HMBS (Hydroxymethylbilane Synthase (HMBS))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HMBS antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: HMBS antibody was raised against the N terminal of HMBS

Purification: Affinity purified

Immunogen: HMBS antibody was raised using the N terminal of HMBS corresponding to a region with amino acids MRVIRVGTRKSQLARIQTDSVVATLKASYPGLQFEIIAMSTTGDKILDTA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HMBS Blocking Peptide, catalog no. 33R-6388, is also available for use as a blocking control in assays to test for specificity of this HMBS antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HMBS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HMBS

Target: HMBS (Hydroxymethylbilane Synthase (HMBS))

Alternative Name: HMBS (HMBS Products)

Synonyms: PBG-D antibody, PBGD antibody, PORC antibody, UPS antibody, URO-S antibody, hemC antibody, pbg-d antibody, pbgd antibody, ups antibody, SPAC806.01 antibody, DDBDRAFT_0186148 antibody, DDBDRAFT_0231417 antibody, DDB_0186148 antibody, DDB_0231417 antibody, Hmbs antibody, NV50236 antibody, T25658 antibody, Ups antibody, Uros1 antibody, hmbs antibody, zgc:64128 antibody, hmbsl antibody, id:ibd5004 antibody, im:7140060 antibody, zgc:110690 antibody, hydroxymethylbilane synthase antibody, hydroxymethylbilane synthase S homeolog antibody, hydroxymethylbilane synthase L homeolog antibody, hydroxymethylbilane synthase (predicted) antibody, Hydroxymethylbilane synthase antibody, hydroxymethylbilane synthase a antibody, hydroxymethylbilane synthase, b antibody, HMBS antibody, Hmbs antibody, hmbs antibody, hmbs.2.S antibody, hmbs.L antibody, CNC02250 antibody, hem3 antibody, hemC antibody, Trad_0335 antibody, Plabr_2100 antibody, Sgly_3113 antibody, SMLT_RS19660 antibody, PMI_RS16580 antibody, hmbsa antibody, hmbsb antibody

Background: HMBS is a member of the hydroxymethylbilane synthase superfamily. It is the third enzyme of the heme biosynthetic pathway and catalyzes the head to tail condensation of four porphobilinogen molecules into the linear hydroxymethylbilane. Mutations in this gene are associated with the autosomal dominant disease acute intermittent porphyria.

Molecular Weight: 38 kDa (MW of target protein)