GCLM antibody (Middle Region)

Catalog No. ABIN631928

Product Details anti-GCLM Antibody

Target: GCLM (Glutamate-Cysteine Ligase, Modifier Subunit (GCLM))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GCLM antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: GCLM antibody was raised against the middle region of GCLM

Purification: Affinity purified

Immunogen: GCLM antibody was raised using the middle region of GCLM corresponding to a region with amino acids KPNSNQVNLASCCVMPPDLTAFAKQFDIQLLTHNDPKELLSEASFQEALQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GCLM Blocking Peptide, catalog no. 33R-4592, is also available for use as a blocking control in assays to test for specificity of this GCLM antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GCLM antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GCLM

Target: GCLM (Glutamate-Cysteine Ligase, Modifier Subunit (GCLM))

Alternative Name: GCLM (GCLM Products)

Synonyms: Glclr antibody, GLCLR antibody, id:ibd3182 antibody, wu:fi24c07 antibody, zgc:55903 antibody, AI649393 antibody, Gcmc antibody, glutamate-cysteine ligase regulatory subunit antibody, glutamate cysteine ligase, modifier subunit antibody, glutamate-cysteine ligase modifier subunit antibody, glutamate-cysteine ligase, modifier subunit antibody, glutamate-cysteine ligase, modifier subunit L homeolog antibody, PTRG_09814 antibody, Gclm antibody, GCLM antibody, gclm antibody, gclm.L antibody

Background: Glutamate-cysteine ligase, also known as gamma-glutamylcysteine synthetase, is the first rate limiting enzyme of glutathione synthesis. The enzyme consists of two subunits, a heavy catalytic subunit and a light regulatory subunit. Gamma glutamylcysteine synthetase deficiency has been implicated in some forms of hemolytic anemia.Glutamate-cysteine ligase, also known as gamma-glutamylcysteine synthetase, is the first rate limiting enzyme of glutathione synthesis.

Molecular Weight: 31 kDa (MW of target protein)