Chromosome 4 Open Reading Fram 46 (C4orf46) (Middle Region) antibody

Details for Product No. ABIN631933
Target
Binding Specificity
Middle Region
9
9
8
4
2
1
1
Reactivity
Human
35
18
4
1
1
1
Host
Rabbit
43
Clonality
Polyclonal
Conjugate
Un-conjugated
5
4
4
2
2
2
2
1
1
1
1
1
1
1
1
1
1
Application
Western Blotting (WB)
27
20
13
3
2
1
1
Options
Immunogen LOC201725 antibody was raised using the middle region of LOC201725 corresponding to a region with amino acids VSLGWPVPSRSSGPTVDQLEEVELQIGDAAFSLTKLLEATSAVSAQVEEL
Specificity LOC201725 antibody was raised against the middle region of LOC201725
Purification Affinity purified
Target
Background The specific function of LOC201725 is not yet known.
Molecular Weight 12 kDa (MW of target protein)
Application Notes WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Comment

LOC201725 Blocking Peptide, catalog no. 33R-9811, is also available for use as a blocking control in assays to test for specificity of this LOC201725 antibody

Restrictions For Research Use only
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LOC201725 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Images
Image no. 1 for anti-Chromosome 4 Open Reading Fram 46 (C4orf46) (Middle Region) antibody (ABIN631933) LOC201725 antibody used at 1 ug/ml to detect target protein.