POLR1E antibody

Catalog No. ABIN631957

Product Details anti-POLR1E Antibody

Target: POLR1E (Polymerase (RNA) I Polypeptide E, 53kDa (POLR1E))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This POLR1E antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: POLR1 E antibody was raised using a synthetic peptide corresponding to a region with amino acids SPGNMRFTLYENKDSTNPRKRNQRILAAETDRLSYVGNNFGTGALKCNTL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

POLR1E Blocking Peptide, catalog no. 33R-8675, is also available for use as a blocking control in assays to test for specificity of this POLR1E antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of POLR0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for POLR1E

Target: POLR1E (Polymerase (RNA) I Polypeptide E, 53kDa (POLR1E))

Alternative Name: POLR1E (POLR1E Products)

Synonyms: 53kDa antibody, AU042259 antibody, D030019D19Rik antibody, Paf53 antibody, Praf1 antibody, PAF53 antibody, PRAF1 antibody, RP11-405L18.3 antibody, RNA polymerase I subunit E antibody, polymerase (RNA) I polypeptide E antibody, polymerase (RNA) I polypeptide E L homeolog antibody, POLR1E antibody, polr1e antibody, Polr1e antibody, polr1e.L antibody

Background: POLR1E is a DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.POLR1E is the component of RNA polymerase I which synthesizes ribosomal RNA precursors.POLR1E appears to be involved in the formation of the initiation complex at the promoter by mediating the interaction between Pol I and UBTF/UBF.

Molecular Weight: 47 kDa (MW of target protein)