CYP26B1 antibody (Middle Region)

Catalog No. ABIN631961

Product Details anti-CYP26B1 Antibody

Target: CYP26B1 (Cytochrome P450, Family 26, Subfamily B, Polypeptide 1 (CYP26B1))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CYP26B1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CYP26 B1 antibody was raised against the middle region of CYP26 1

Purification: Affinity purified

Immunogen: CYP26 B1 antibody was raised using the middle region of CYP26 1 corresponding to a region with amino acids SRFELATRTFPRITLVPVLHPVDGLSVKFFGLDSNQNEILPETEAMLSAT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CYP26B1 Blocking Peptide, catalog no. 33R-8748, is also available for use as a blocking control in assays to test for specificity of this CYP26B1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYP20 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CYP26B1

Target: CYP26B1 (Cytochrome P450, Family 26, Subfamily B, Polypeptide 1 (CYP26B1))

Alternative Name: CYP26B1 (CYP26B1 Products)

Synonyms: cyp26b1 antibody, cyp26a2 antibody, p450rai-2 antibody, CYP26A2 antibody, P450RAI-2 antibody, P450RAI2 antibody, RHFCA antibody, CP26 antibody, fc21d03 antibody, wu:fc21d03 antibody, wu:fc26h10 antibody, zgc:76999 antibody, cytochrome P450 26B1 antibody, cytochrome P450 family 26 subfamily B member 1 L homeolog antibody, cytochrome P450 family 26 subfamily B member 1 antibody, cytochrome P450, family 26, subfamily B, polypeptide 1 antibody, cytochrome P450, family 26, subfamily b, polypeptide 1 antibody, CpipJ_CPIJ002537 antibody, cyp26b1.L antibody, CYP26B1 antibody, cyp26b1 antibody, Cyp26b1 antibody

Background: This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases that catalyze many reactions involved in drug metabolism and the synthesis of cholesterol, steroids and other lipids. The enzyme encoded by this gene is involved in the specific inactivation of all-trans-retinoic acid to hydroxylated forms, such as 4-oxo-, 4-OH-, and 18-OH-all-trans-retinoic acid.

Molecular Weight: 57 kDa (MW of target protein)

Pathways: Retinoic Acid Receptor Signaling Pathway, Regulation of Muscle Cell Differentiation, Monocarboxylic Acid Catabolic Process