CYP26B1 antibody (Middle Region)
-
- Target See all CYP26B1 Antibodies
- CYP26B1 (Cytochrome P450, Family 26, Subfamily B, Polypeptide 1 (CYP26B1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CYP26B1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CYP26 B1 antibody was raised against the middle region of CYP26 1
- Purification
- Affinity purified
- Immunogen
- CYP26 B1 antibody was raised using the middle region of CYP26 1 corresponding to a region with amino acids SRFELATRTFPRITLVPVLHPVDGLSVKFFGLDSNQNEILPETEAMLSAT
- Top Product
- Discover our top product CYP26B1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CYP26B1 Blocking Peptide, catalog no. 33R-8748, is also available for use as a blocking control in assays to test for specificity of this CYP26B1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYP20 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CYP26B1 (Cytochrome P450, Family 26, Subfamily B, Polypeptide 1 (CYP26B1))
- Alternative Name
- CYP26B1 (CYP26B1 Products)
- Synonyms
- cyp26b1 antibody, cyp26a2 antibody, p450rai-2 antibody, CYP26A2 antibody, P450RAI-2 antibody, P450RAI2 antibody, RHFCA antibody, CP26 antibody, fc21d03 antibody, wu:fc21d03 antibody, wu:fc26h10 antibody, zgc:76999 antibody, cytochrome P450 26B1 antibody, cytochrome P450 family 26 subfamily B member 1 L homeolog antibody, cytochrome P450 family 26 subfamily B member 1 antibody, cytochrome P450, family 26, subfamily B, polypeptide 1 antibody, cytochrome P450, family 26, subfamily b, polypeptide 1 antibody, CpipJ_CPIJ002537 antibody, cyp26b1.L antibody, CYP26B1 antibody, cyp26b1 antibody, Cyp26b1 antibody
- Background
- This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases that catalyze many reactions involved in drug metabolism and the synthesis of cholesterol, steroids and other lipids. The enzyme encoded by this gene is involved in the specific inactivation of all-trans-retinoic acid to hydroxylated forms, such as 4-oxo-, 4-OH-, and 18-OH-all-trans-retinoic acid.
- Molecular Weight
- 57 kDa (MW of target protein)
- Pathways
- Retinoic Acid Receptor Signaling Pathway, Regulation of Muscle Cell Differentiation, Monocarboxylic Acid Catabolic Process
-