GABARAPL2 antibody
-
- Target See all GABARAPL2 Antibodies
- GABARAPL2 (GABA(A) Receptor-Associated Protein-Like 2 (GABARAPL2))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This GABARAPL2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- GABARAPL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids KWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLV
- Top Product
- Discover our top product GABARAPL2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
GABARAPL2 Blocking Peptide, catalog no. 33R-4731, is also available for use as a blocking control in assays to test for specificity of this GABARAPL2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GABARAPL2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GABARAPL2 (GABA(A) Receptor-Associated Protein-Like 2 (GABARAPL2))
- Alternative Name
- GABARAPL2 (GABARAPL2 Products)
- Synonyms
- GABARAPL2 antibody, atg8 antibody, gef2 antibody, gate16 antibody, gate-16 antibody, Gef2 antibody, ATG8 antibody, ATG8C antibody, GATE-16 antibody, GATE16 antibody, GEF-2 antibody, GEF2 antibody, zgc:92319 antibody, 0610012F20Rik antibody, 2900019O08Rik antibody, AI173605 antibody, GABA type A receptor associated protein like 2 antibody, GABA(A) receptor-associated protein like 2 antibody, GABA(A) receptor-associated protein like 2 L homeolog antibody, gamma-aminobutyric acid (GABA) A receptor-associated protein-like 2 antibody, GABARAPL2 antibody, gabarapl2 antibody, Gabarapl2 antibody, gabarapl2.L antibody
- Background
- GABARAPL2 belongs to the MAP1 LC3 family. It modulates intra-Golgi transport through coupling between NSF activity and SNAREs activation. The protein first stimulates the ATPase activity of NSF which in turn stimulates the association with GOSR1.
- Molecular Weight
- 14 kDa (MW of target protein)
- Pathways
- Autophagy
-