SLAIN1 antibody (Middle Region)
-
- Target See all SLAIN1 products
- SLAIN1 (SLAIN Motif Family, Member 1 (SLAIN1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SLAIN1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SLAIN1 antibody was raised against the middle region of SLAIN1
- Purification
- Affinity purified
- Immunogen
- SLAIN1 antibody was raised using the middle region of SLAIN1 corresponding to a region with amino acids RSPSSQYFPSNNYQQQQYYSPQAQTPDQQPNRTNGDKLRRSMPNLARMPS
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SLAIN1 Blocking Peptide, catalog no. 33R-8203, is also available for use as a blocking control in assays to test for specificity of this SLAIN1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLAIN1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLAIN1 (SLAIN Motif Family, Member 1 (SLAIN1))
- Alternative Name
- SLAIN1 (SLAIN1 Products)
- Synonyms
- 9630044O09Rik antibody, AA675320 antibody, AW742596 antibody, C13orf32 antibody, RGD1308626 antibody, zgc:175146 antibody, SLAIN motif family member 1 antibody, SLAIN motif family, member 1 antibody, SLAIN motif family, member 1b antibody, SLAIN1 antibody, Slain1 antibody, slain1b antibody
- Background
- The function of SLAIN1 protein has not been widely studied, and is yet to be fully elucidated.
- Molecular Weight
- 38 kDa (MW of target protein)
-