SLAIN1 antibody (Middle Region)

Catalog No. ABIN631967

Product Details anti-SLAIN1 Antibody

Target: SLAIN1 (SLAIN Motif Family, Member 1 (SLAIN1))

Binding Specificity: Middle Region

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLAIN1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SLAIN1 antibody was raised against the middle region of SLAIN1

Purification: Affinity purified

Immunogen: SLAIN1 antibody was raised using the middle region of SLAIN1 corresponding to a region with amino acids RSPSSQYFPSNNYQQQQYYSPQAQTPDQQPNRTNGDKLRRSMPNLARMPS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLAIN1 Blocking Peptide, catalog no. 33R-8203, is also available for use as a blocking control in assays to test for specificity of this SLAIN1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLAIN1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLAIN1

Target: SLAIN1 (SLAIN Motif Family, Member 1 (SLAIN1))

Alternative Name: SLAIN1 (SLAIN1 Products)

Synonyms: 9630044O09Rik antibody, AA675320 antibody, AW742596 antibody, C13orf32 antibody, RGD1308626 antibody, zgc:175146 antibody, SLAIN motif family member 1 antibody, SLAIN motif family, member 1 antibody, SLAIN motif family, member 1b antibody, SLAIN1 antibody, Slain1 antibody, slain1b antibody

Background: The function of SLAIN1 protein has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 38 kDa (MW of target protein)