TPGS2 antibody (Middle Region)

Catalog No. ABIN631976

Product Details anti-TPGS2 Antibody

Target: TPGS2 (C18orf10) (Chromosome 18 Open Reading Frame 10 (C18orf10))

Binding Specificity: Middle Region

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TPGS2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: C18 ORF10 antibody was raised against the middle region of C18 rf10

Purification: Affinity purified

Immunogen: C18 ORF10 antibody was raised using the middle region of C18 rf10 corresponding to a region with amino acids SMYSLPNAPTLADLEDDTHEASDDQPEKPHFDSRSVIFELDSCNGSGKVC

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C18ORF10 Blocking Peptide, catalog no. 33R-8647, is also available for use as a blocking control in assays to test for specificity of this C18ORF10 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TPGS2

Target: TPGS2 (C18orf10) (Chromosome 18 Open Reading Frame 10 (C18orf10))

Alternative Name: C18ORF10 (C18orf10 Products)

Synonyms: C18orf10 antibody, L17 antibody, PGs2 antibody, CZH18orf10 antibody, c18orf10 antibody, DKFZp468A177 antibody, 5730437P09Rik antibody, 5730494M16Rik antibody, AI666318 antibody, Pgs2 antibody, RGD1310571 antibody, C24H18orf10 antibody, zgc:91821 antibody, tubulin polyglutamylase complex subunit 2 antibody, tubulin polyglutamylase complex subunit 2 L homeolog antibody, TPGS2 antibody, tpgs2.L antibody, tpgs2 antibody, C18orf10 antibody, Tpgs2 antibody

Background: The function of C18orf10 has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 33 kDa (MW of target protein)