FANCL antibody (Middle Region)
-
- Target See all FANCL Antibodies
- FANCL (Fanconi Anemia, Complementation Group L (FANCL))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This FANCL antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- FANCL antibody was raised against the middle region of FANCL
- Purification
- Affinity purified
- Immunogen
- FANCL antibody was raised using the middle region of FANCL corresponding to a region with amino acids ASGREHLITLKLKAKYPAESPDYFVDFPVPFCASWTPQVNSPQSSLISIY
- Top Product
- Discover our top product FANCL Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
FANCL Blocking Peptide, catalog no. 33R-1506, is also available for use as a blocking control in assays to test for specificity of this FANCL antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FANCL antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FANCL (Fanconi Anemia, Complementation Group L (FANCL))
- Alternative Name
- FANCL (FANCL Products)
- Synonyms
- FAAP43 antibody, PHF9 antibody, POG antibody, 2010322C19Rik antibody, AW554273 antibody, B230118H11Rik antibody, Phf9 antibody, Pog antibody, gcd antibody, Fanconi anemia complementation group L antibody, Fanconi anemia, complementation group L antibody, FANCL antibody, Fancl antibody
- Background
- The Fanconi anemia complementation group (FANC) currently includes FANCA, FANCB, FANCC, FANCD1 (also called BRCA2), FANCD2, FANCE, FANCF, FANCG, FANCI, FANCJ (also called BRIP1), FANCL, FANCM and FANCN (also called PALB2). The previously defined group FANCH is the same as FANCA. Fanconi anemia is a genetically heterogeneous recessive disorder characterized by cytogenetic instability, hypersensitivity to DNA crosslinking agents, increased chromosomal breakage, and defective DNA repair.
- Molecular Weight
- 42 kDa (MW of target protein)
- Pathways
- DNA Damage Repair
-