FANCL antibody (Middle Region)

Catalog No. ABIN631983

Product Details anti-FANCL Antibody

Target: FANCL (Fanconi Anemia, Complementation Group L (FANCL))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FANCL antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: FANCL antibody was raised against the middle region of FANCL

Purification: Affinity purified

Immunogen: FANCL antibody was raised using the middle region of FANCL corresponding to a region with amino acids ASGREHLITLKLKAKYPAESPDYFVDFPVPFCASWTPQVNSPQSSLISIY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FANCL Blocking Peptide, catalog no. 33R-1506, is also available for use as a blocking control in assays to test for specificity of this FANCL antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FANCL antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FANCL

Target: FANCL (Fanconi Anemia, Complementation Group L (FANCL))

Alternative Name: FANCL (FANCL Products)

Synonyms: FAAP43 antibody, PHF9 antibody, POG antibody, 2010322C19Rik antibody, AW554273 antibody, B230118H11Rik antibody, Phf9 antibody, Pog antibody, gcd antibody, Fanconi anemia complementation group L antibody, Fanconi anemia, complementation group L antibody, FANCL antibody, Fancl antibody

Background: The Fanconi anemia complementation group (FANC) currently includes FANCA, FANCB, FANCC, FANCD1 (also called BRCA2), FANCD2, FANCE, FANCF, FANCG, FANCI, FANCJ (also called BRIP1), FANCL, FANCM and FANCN (also called PALB2). The previously defined group FANCH is the same as FANCA. Fanconi anemia is a genetically heterogeneous recessive disorder characterized by cytogenetic instability, hypersensitivity to DNA crosslinking agents, increased chromosomal breakage, and defective DNA repair.

Molecular Weight: 42 kDa (MW of target protein)

Pathways: DNA Damage Repair