VPS26B antibody
-
- Target See all VPS26B Antibodies
- VPS26B (Vacuolar Protein Sorting 26 Homolog B (VPS26B))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This VPS26B antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- VPS26 B antibody was raised using a synthetic peptide corresponding to a region with amino acids AGYELTPTMRDINKKFSVRYYLNLVLIDEEERRYFKQQEVVLWRKGDIVR
- Top Product
- Discover our top product VPS26B Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
VPS26B Blocking Peptide, catalog no. 33R-1235, is also available for use as a blocking control in assays to test for specificity of this VPS26B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VPS20 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- VPS26B (Vacuolar Protein Sorting 26 Homolog B (VPS26B))
- Alternative Name
- VPS26B (VPS26B Products)
- Synonyms
- VPS26B antibody, wu:fb49d07 antibody, wu:fb50d06 antibody, zgc:56297 antibody, pep8b antibody, vps26b antibody, Pep8b antibody, VP26B antibody, 1810012I05Rik antibody, 2310075A12Rik antibody, AI848392 antibody, T29A15.180 antibody, T29A15_180 antibody, vacuolar protein sorting 26B antibody, vacuolar protein sorting 26 homolog B (S. pombe) antibody, VPS26, retromer complex component B antibody, VPS26 retromer complex component B antibody, VPS26 retromer complex component B S homeolog antibody, vacuolar protein sorting 26B antibody, VPS26B antibody, vps26b antibody, vps26b.S antibody, Vps26b antibody
- Background
- VPS26B belongs to the VPS26 family. VPS26B is probable component of the retromer complex, a complex required to retrieve lysosomal enzyme receptors (IGF2R and M6PR) from endosomes to the trans-Golgi network.
- Molecular Weight
- 39 kDa (MW of target protein)
- Pathways
- Cellular Glucan Metabolic Process
-