CYP11B2 antibody (Middle Region)
-
- Target See all CYP11B2 Antibodies
- CYP11B2 (Cytochrome P450, Family 11, Subfamily B, Polypeptide 2 (CYP11B2))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CYP11B2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CYP11 B2 antibody was raised against the middle region of CYP11 2
- Purification
- Affinity purified
- Immunogen
- CYP11 B2 antibody was raised using the middle region of CYP11 2 corresponding to a region with amino acids RRLAEAEMLLLLHHVLKHFLVETLTQEDIKMVYSFILRPGTSPLLTFRAI
- Top Product
- Discover our top product CYP11B2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CYP11B2 Blocking Peptide, catalog no. 33R-8145, is also available for use as a blocking control in assays to test for specificity of this CYP11B2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYP10 2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CYP11B2 (Cytochrome P450, Family 11, Subfamily B, Polypeptide 2 (CYP11B2))
- Alternative Name
- CYP11B2 (CYP11B2 Products)
- Synonyms
- ALDOS antibody, CPN2 antibody, CYP11B antibody, CYP11BL antibody, CYPXIB2 antibody, P-450C18 antibody, P450C18 antibody, P450aldo antibody, Cpn2 antibody, Cyp11b antibody, Cyp11b-2 antibody, Cp45as antibody, Cyp11b3 antibody, RNCP45AS antibody, cytochrome P450 family 11 subfamily B member 2 antibody, cytochrome P450, family 11, subfamily b, polypeptide 2 antibody, aldosterone synthase antibody, cytochrome P450, family 11, subfamily B, polypeptide 2 antibody, cytochrome P450, subfamily XIB (steroid 11-beta-hydroxylase), polypeptide 2 antibody, CYP11B2 antibody, Cyp11b2 antibody
- Background
- This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids.
- Molecular Weight
- 55 kDa (MW of target protein)
- Pathways
- ACE Inhibitor Pathway, Metabolism of Steroid Hormones and Vitamin D, Steroid Hormone Biosynthesis, Regulation of Systemic Arterial Blood Pressure by Hormones, C21-Steroid Hormone Metabolic Process, Feeding Behaviour
-