NDUFS1 antibody (Middle Region)

Catalog No. ABIN632032

Product Details anti-NDUFS1 Antibody

Target: NDUFS1 (NADH Dehydrogenase (Ubiquinone) Fe-S Protein 1, 75kDa (NADH-Coenzyme Q Reductase) (NDUFS1))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NDUFS1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: NDUFS1 antibody was raised against the middle region of NDUFS1

Purification: Affinity purified

Immunogen: NDUFS1 antibody was raised using the middle region of NDUFS1 corresponding to a region with amino acids TPPGLAREDWKIIRALSEIAGMTLPYDTLDQVRNRLEEVSPNLVRYDDIE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NDUFS1 Blocking Peptide, catalog no. 33R-9227, is also available for use as a blocking control in assays to test for specificity of this NDUFS1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NDUFS1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NDUFS1

Target: NDUFS1 (NADH Dehydrogenase (Ubiquinone) Fe-S Protein 1, 75kDa (NADH-Coenzyme Q Reductase) (NDUFS1))

Alternative Name: NDUFS1 (NDUFS1 Products)

Synonyms: 5830412M15Rik antibody, 9930026A05Rik antibody, CI-75Kd antibody, CI-75k antibody, PRO1304 antibody, NADH dehydrogenase (ubiquinone) Fe-S protein 1 antibody, NADH:ubiquinone oxidoreductase core subunit S1 antibody, Ndufs1 antibody, NDUFS1 antibody

Background: The protein encoded by this gene belongs to the complex I 75 kDa subunit family. Mammalian complex I is composed of 45 different subunits. It locates at the mitochondrial inner membrane. This protein has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. This protein is the largest subunit of complex I and it is a component of the iron-sulfur (IP) fragment of the enzyme. It may form part of the active site crevice where NADH is oxidized. Mutations in this gene are associated with complex I deficiency.

Molecular Weight: 77 kDa (MW of target protein)