EN1 antibody (C-Term)

Catalog No. ABIN632046

Product Details anti-EN1 Antibody

Target: EN1 (Engrailed Homeobox 1 (EN1))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This EN1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: EN1 antibody was raised against the C terminal of EN1

Purification: Affinity purified

Immunogen: EN1 antibody was raised using the C terminal of EN1 corresponding to a region with amino acids LMGSANGGPVVKTDSQQPLVWPAWVYCTRYSDRPSSGPRTRKLKKKKNEK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

EN1 Blocking Peptide, catalog no. 33R-5203, is also available for use as a blocking control in assays to test for specificity of this EN1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EN1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for EN1

Target: EN1 (Engrailed Homeobox 1 (EN1))

Alternative Name: EN1 (EN1 Products)

Synonyms: EN1 antibody, En-1 antibody, Mo-en.1 antibody, ENG-1 antibody, en-1 antibody, en1 antibody, eng1 antibody, zgc:100771 antibody, en1-A antibody, engrailed-1 antibody, xen1 antibody, Gg-En-1 antibody, en-3 antibody, engrailed antibody, engrailed homeobox 1 antibody, engrailed 1 antibody, engrailed homeobox 1a antibody, engrailed homeobox 1 S homeolog antibody, EN1 antibody, En1 antibody, en1a antibody, en1.S antibody

Background: Homeobox-containing genes are thought to have a role in controlling development. In Drosophila, the 'engrailed' (en) gene plays an important role during development in segmentation, where it is required for the formation of posterior compartments. Different mutations in the mouse homologs, En1 and En2, produced different developmental defects that frequently are lethal. The human engrailed homologs 1 and 2 encode homeodomain-containing proteins and have been implicated in the control of pattern formation during development of the central nervous system.Homeobox-containing genes are thought to have a role in controlling development.

Molecular Weight: 40 kDa (MW of target protein)

Pathways: Dopaminergic Neurogenesis