ARL8B antibody (Middle Region)
-
- Target See all ARL8B Antibodies
- ARL8B (ADP-Ribosylation Factor-Like 8B (ARL8B))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ARL8B antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ARL8 B antibody was raised against the middle region of ARL8
- Purification
- Affinity purified
- Immunogen
- ARL8 B antibody was raised using the middle region of ARL8 corresponding to a region with amino acids DIGGQPRFRSMWERYCRGVNAIVYMIDAADREKIEASRNELHNLLDKPQL
- Top Product
- Discover our top product ARL8B Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ARL8B Blocking Peptide, catalog no. 33R-1997, is also available for use as a blocking control in assays to test for specificity of this ARL8B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARL0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ARL8B (ADP-Ribosylation Factor-Like 8B (ARL8B))
- Alternative Name
- ARL8B (ARL8B Products)
- Synonyms
- ARL10C antibody, Gie1 antibody, 2610313E07Rik antibody, 3100002J04Rik antibody, Arl10c antibody, gie1 antibody, ADP ribosylation factor like GTPase 8B antibody, ADP-ribosylation factor-like 8B antibody, ADP-ribosylation factor like GTPase 8B antibody, ARL8B antibody, Arl8b antibody
- Background
- ARL8B may play a role in lysosome motility and chromosome segregation.
- Molecular Weight
- 21 kDa (MW of target protein)
-