PI4K2B antibody (Middle Region)

Catalog No. ABIN632063

Product Details anti-PI4K2B Antibody

Target: PI4K2B (Phosphatidylinositol 4-Kinase Type 2 beta (PI4K2B))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PI4K2B antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PI4 K4 antibody was raised against the middle region of PI4 4

Purification: Affinity purified

Immunogen: PI4 K4 antibody was raised using the middle region of PI4 4 corresponding to a region with amino acids IIGVFKPKSEEPYGQLNPKWTKYVHKVCCPCCFGRGCLIPNQGYLSEAGA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PI4K2B Blocking Peptide, catalog no. 33R-3999, is also available for use as a blocking control in assays to test for specificity of this PI4K2B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PI0 0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PI4K2B

Target: PI4K2B (Phosphatidylinositol 4-Kinase Type 2 beta (PI4K2B))

Alternative Name: PI4K2B (PI4K2B Products)

Synonyms: GB16449 antibody, pi4kiib antibody, pik42b antibody, PI4KIIB antibody, PIK42B antibody, 2610042N09Rik antibody, 4933409G22Rik antibody, zgc:158305 antibody, uncharacterized LOC725812 antibody, phosphatidylinositol 4-kinase type 2 beta L homeolog antibody, phosphatidylinositol 4-kinase type 2 beta antibody, LOC725812 antibody, pi4k2b.L antibody, PI4K2B antibody, pi4k2b antibody, Pi4k2b antibody

Background: Phosphatidylinositol 4-kinases (PI4Ks) phosphorylate phosphatidylinositol to generate phosphatidylinositol 4-phosphate (PIP), an immediate precursor of several important signaling and scaffolding molecules.

Molecular Weight: 55 kDa (MW of target protein)

Pathways: Inositol Metabolic Process