AGAP2 antibody (Middle Region)

Catalog No. ABIN632064

Product Details anti-AGAP2 Antibody

Target: AGAP2 (ArfGAP with GTPase Domain, Ankyrin Repeat and PH Domain 2 (AGAP2))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This AGAP2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CENTG1 antibody was raised against the middle region of CENTG1

Purification: Affinity purified

Immunogen: CENTG1 antibody was raised using the middle region of CENTG1 corresponding to a region with amino acids AHARHGPLDTSVEDPQLRSPLHLAAELAHVVITQLLLWYGADVAARDAQG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CENTG1 Blocking Peptide, catalog no. 33R-1240, is also available for use as a blocking control in assays to test for specificity of this CENTG1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CENTG1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for AGAP2

Target: AGAP2 (ArfGAP with GTPase Domain, Ankyrin Repeat and PH Domain 2 (AGAP2))

Alternative Name: CENTG1 (AGAP2 Products)

Background: CENTG1 is a GTPase-activating protein (GAP) for ARF1 and ARF5, which also shows strong GTPase activity. Isoform 1 participates in the prevention of neuronal apoptosis by enhancing PI3 kinase activity. It aids the coupling of metabotropic glutamate receptor 1 (GRM1) to cytoplasmic PI3 kinase by interacting with Homer scaffolding proteins, and also seems to mediate anti-apoptotic effects of NGF by activating nuclear PI3 kinase. Isoform 2 does not stimulate PI3 kinase but may protect cells from apoptosis by stimulating Akt. It also regulates the adapter protein 1 (AP-1)-dependent trafficking of proteins in the endosomal system. It seems to be oncogenic. It is overexpressed in cancer cells, prevents apoptosis and promotes cancer cell invasion.

Molecular Weight: 90 kDa (MW of target protein)