IPPK antibody (Middle Region)

Catalog No. ABIN632070

Product Details anti-IPPK Antibody

Target: IPPK (Inositol 1,3,4,5,6-Pentakisphosphate 2-Kinase (IPPK))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This IPPK antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: IPPK antibody was raised against the middle region of IPPK

Purification: Affinity purified

Immunogen: IPPK antibody was raised using the middle region of IPPK corresponding to a region with amino acids KTLQVQMLDLLDIEGLYPLYNRVERYLEEFPEERKTLQIDGPYDEAFYQK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

IPPK Blocking Peptide, catalog no. 33R-4685, is also available for use as a blocking control in assays to test for specificity of this IPPK antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IPPK antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for IPPK

Target: IPPK (Inositol 1,3,4,5,6-Pentakisphosphate 2-Kinase (IPPK))

Alternative Name: IPPK (IPPK Products)

Synonyms: IPPK antibody, MGC146756 antibody, C9orf12 antibody, INSP5K2 antibody, IP5K antibody, IPK1 antibody, bA476B13.1 antibody, 1810043M15Rik antibody, InsP6 antibody, RGD1311271 antibody, rIpk1 antibody, ipk1 antibody, ipk1l antibody, si:dkey-42i9.3 antibody, zgc:110769 antibody, ATIPK1 antibody, M40H3 antibody, MJB21.19 antibody, MJB21_19 antibody, inositol-pentakisphosphate 2-kinase 1 antibody, inositol-pentakisphosphate 2-kinase antibody, inositol 1,3,4,5,6-pentakisphosphate 2-kinase antibody, inositol pentakisphosphate 2-kinase antibody, inositol-pentakisphosphate 2-kinase 1 antibody, IPPK antibody, LOC521083 antibody, ippk antibody, Ippk antibody, IPK1 antibody

Background: IPPK phosphorylates Ins(1,3,4,5,6)P5 at position 2 to form Ins(1,2,3,4,5,6)P6 (InsP6 or phytate). InsP6 is involved in many processes such as mRNA export, non-homologous end-joining, endocytosis, ion channel regulation. It also protects cells from TNF-alpha-induced apoptosis.

Molecular Weight: 56 kDa (MW of target protein)