ACTR3B antibody

Catalog No. ABIN632090

Product Details anti-ACTR3B Antibody

Target: ACTR3B (ARP3 Actin-Related Protein 3 Homolog B (ACTR3B))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ACTR3B antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: ACTR3 B antibody was raised using a synthetic peptide corresponding to a region with amino acids DHYFLMTEPPLNTPENREYLAEIMFESFNVPGLYIAVQAVLALAASWTSR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ACTR3B Blocking Peptide, catalog no. 33R-1986, is also available for use as a blocking control in assays to test for specificity of this ACTR3B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACTR0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ACTR3B

Target: ACTR3B (ARP3 Actin-Related Protein 3 Homolog B (ACTR3B))

Alternative Name: ACTR3B (ACTR3B Products)

Synonyms: RGD1565759 antibody, ARP11 antibody, ARP3BETA antibody, 9630005C02 antibody, AW047569 antibody, Arp3b antibody, Arp3beta antibody, ARP3 actin related protein 3 homolog B antibody, ARP3 actin-related protein 3B antibody, Actr3b antibody, ACTR3B antibody

Background: ACTR3B may function as ATP-binding component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks. ACTR3B may decrease the metastatic potential of tumors.

Molecular Weight: 47 kDa (MW of target protein)

Pathways: Regulation of Actin Filament Polymerization