CES2 antibody

Catalog No. ABIN632102

Product Details anti-CES2 Antibody

Target: CES2 (Carboxylesterase 2 (CES2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CES2 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: Carboxylesterase 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids HWPLFDQEEQYLQLNLQPAVGRALKAHRLQFWKKALPQKIQELEEPEERH

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Carboxylesterase 2 Blocking Peptide, catalog no. 33R-3874, is also available for use as a blocking control in assays to test for specificity of this Carboxylesterase 2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CES2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CES2

Target: CES2 (Carboxylesterase 2 (CES2))

Alternative Name: Carboxylesterase 2 (CES2 Products)

Synonyms: CE-2 antibody, CES2A1 antibody, PCE-2 antibody, iCE antibody, Ces2 antibody, im:6908784 antibody, si:dkey-38l12.2 antibody, zgc:153863 antibody, ce-2 antibody, ces2a1 antibody, pce-2 antibody, carboxylesterase 2 antibody, liver carboxylesterase 2 antibody, cocaine esterase antibody, carboxylesterase 2 (intestine, liver) antibody, CES2 antibody, Ces2 antibody, LOC100343300 antibody, LOC100734360 antibody, ces2 antibody

Background: Carboxylesterase 2 is a member of a large multigene family. The enzymes are responsible for the hydrolysis of ester- and amide-bond-containing drugs such as cocaine and heroin. They also hydrolize long-chain fatty acid esters and thioesters. The specific function of this enzyme has not yet been determined, however, it is speculated that carboxylesterases may play a role in lipid metabolism and/or the blood-brain barrier system.

Molecular Weight: 69 kDa (MW of target protein)