ASPHD2 antibody (Middle Region)

Catalog No. ABIN632104

Product Details anti-ASPHD2 Antibody

Target: ASPHD2 (Aspartate beta-Hydroxylase Domain Containing 2 (ASPHD2))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ASPHD2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ASPHD2 antibody was raised against the middle region of ASPHD2

Purification: Affinity purified

Immunogen: ASPHD2 antibody was raised using the middle region of ASPHD2 corresponding to a region with amino acids YCQSPECVRCTHNEGLNQKLYHNLQEYAKRYSWSGMGRIHKGIREQGRYL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ASPHD2 Blocking Peptide, catalog no. 33R-10060, is also available for use as a blocking control in assays to test for specificity of this ASPHD2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ASPHD2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ASPHD2

Target: ASPHD2 (Aspartate beta-Hydroxylase Domain Containing 2 (ASPHD2))

Alternative Name: ASPHD2 (ASPHD2 Products)

Synonyms: 2900006N09Rik antibody, 9230106G13Rik antibody, RGD1306020 antibody, zgc:153516 antibody, aspartate beta-hydroxylase domain containing 2 antibody, ASPHD2 antibody, asphd2 antibody, Asphd2 antibody

Background: The function of ASPH protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 39 kDa (MW of target protein)