RUVBL2 antibody
-
- Target See all RUVBL2 Antibodies
- RUVBL2 (RuvB-Like 2 (E. Coli) (RUVBL2))
-
Reactivity
- Human, Mouse, Rat, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RUVBL2 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Purification
- Affinity purified
- Immunogen
- RUVBL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids IDRPATGTGSKVGKLTLKTTEMETIYDLGTKMIESLTKDKVQAGDVITID
- Top Product
- Discover our top product RUVBL2 Primary Antibody
-
-
- Application Notes
-
WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RUVBL2 Blocking Peptide, catalog no. 33R-3928, is also available for use as a blocking control in assays to test for specificity of this RUVBL2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RUVBL2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RUVBL2 (RuvB-Like 2 (E. Coli) (RUVBL2))
- Alternative Name
- RUVBL2 (RUVBL2 Products)
- Synonyms
- ECP51 antibody, INO80J antibody, REPTIN antibody, RVB2 antibody, TIH2 antibody, TIP48 antibody, TIP49B antibody, mp47 antibody, p47 antibody, reptin antibody, wu:fi25f01 antibody, zreptin antibody, MGC52995 antibody, tip48 antibody, xReptin antibody, rvb2 antibody, ecp51 antibody, cgi-46 antibody, tip49b antibody, MGC69398 antibody, RUVBL2 antibody, AAEL010341 antibody, Reptin antibody, rept antibody, RuvB like AAA ATPase 2 antibody, RuvB-like protein 2 antibody, RuvB-like AAA ATPase 2 antibody, RuvB like AAA ATPase 2 L homeolog antibody, ruvB-like 2 antibody, TATA box-binding protein antibody, ruvb-like 2 antibody, ruvB-like helicase 2 antibody, RUVBL2 antibody, Ruvbl2 antibody, ruvbl2 antibody, ruvbl2.L antibody, LOC726816 antibody, HBUT_RS02095 antibody, HAN_2g314 antibody, LOC100282179 antibody, LOC100284260 antibody, LOC5573243 antibody
- Background
- RUVBL2 encodes the second human homologue of the bacterial RuvB gene. Bacterial RuvB protein is a DNA helicase essential for homologous recombination and DNA double-strand break repair. Functional analysis showed that this gene product has both ATPase and DNA helicase activities.
- Molecular Weight
- 51 kDa (MW of target protein)
- Pathways
- Telomere Maintenance
-