RUVBL2 antibody

Catalog No. ABIN632139

Product Details anti-RUVBL2 Antibody

Target: RUVBL2 (RuvB-Like 2 (E. Coli) (RUVBL2))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RUVBL2 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Affinity purified

Immunogen: RUVBL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids IDRPATGTGSKVGKLTLKTTEMETIYDLGTKMIESLTKDKVQAGDVITID

Application Details

Application Notes: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RUVBL2 Blocking Peptide, catalog no. 33R-3928, is also available for use as a blocking control in assays to test for specificity of this RUVBL2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RUVBL2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RUVBL2

Target: RUVBL2 (RuvB-Like 2 (E. Coli) (RUVBL2))

Alternative Name: RUVBL2 (RUVBL2 Products)

Synonyms: ECP51 antibody, INO80J antibody, REPTIN antibody, RVB2 antibody, TIH2 antibody, TIP48 antibody, TIP49B antibody, mp47 antibody, p47 antibody, reptin antibody, wu:fi25f01 antibody, zreptin antibody, MGC52995 antibody, tip48 antibody, xReptin antibody, rvb2 antibody, ecp51 antibody, cgi-46 antibody, tip49b antibody, MGC69398 antibody, RUVBL2 antibody, AAEL010341 antibody, Reptin antibody, rept antibody, RuvB like AAA ATPase 2 antibody, RuvB-like protein 2 antibody, RuvB-like AAA ATPase 2 antibody, RuvB like AAA ATPase 2 L homeolog antibody, ruvB-like 2 antibody, TATA box-binding protein antibody, ruvb-like 2 antibody, ruvB-like helicase 2 antibody, RUVBL2 antibody, Ruvbl2 antibody, ruvbl2 antibody, ruvbl2.L antibody, LOC726816 antibody, HBUT_RS02095 antibody, HAN_2g314 antibody, LOC100282179 antibody, LOC100284260 antibody, LOC5573243 antibody

Background: RUVBL2 encodes the second human homologue of the bacterial RuvB gene. Bacterial RuvB protein is a DNA helicase essential for homologous recombination and DNA double-strand break repair. Functional analysis showed that this gene product has both ATPase and DNA helicase activities.

Molecular Weight: 51 kDa (MW of target protein)

Pathways: Telomere Maintenance