SS18L1 antibody (Middle Region)

Catalog No. ABIN632142

Product Details anti-SS18L1 Antibody

Target: SS18L1 (Synovial Sarcoma Translocation Gene On Chromosome 18-Like 1 (SS18L1))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SS18L1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SS18 L1 antibody was raised against the middle region of SS18 1

Purification: Affinity purified

Immunogen: SS18 L1 antibody was raised using the middle region of SS18 1 corresponding to a region with amino acids EYYGEQYSHSQGAAEPMGQQYYPDGHGDYAYQQSSYTEQSYDRSFEESTQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SS18L1 Blocking Peptide, catalog no. 33R-2833, is also available for use as a blocking control in assays to test for specificity of this SS18L1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SS10 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SS18L1

Target: SS18L1 (Synovial Sarcoma Translocation Gene On Chromosome 18-Like 1 (SS18L1))

Alternative Name: SS18L1 (SS18L1 Products)

Synonyms: crest antibody, CREST antibody, LP2261 antibody, A230053O16Rik antibody, SS18L1, nBAF chromatin remodeling complex subunit antibody, synovial sarcoma translocation gene on chromosome 18-like 1 antibody, synovial sarcoma translocation gene on chromosome 18-like 1 S homeolog antibody, SS18, nBAF chromatin remodeling complex subunit like 1 antibody, SS18L1 antibody, ss18l1 antibody, ss18l1.S antibody, Ss18l1 antibody

Background: Synovial sarcomas occur most frequently in the extremities around large joints. More than 90% of cases have a recurrent and specific chromosomal translocation, t(X,18)(p11.2,q11.2), in which the 5-prime end of the SS18 gene is fused in-frame to the 3-prime end of the SSX1, SSX2, or SSX4 gene. The SS18L1 gene is homologous to SS18.

Molecular Weight: 43 kDa (MW of target protein)