-
- Target See all TRIB3 Antibodies
- TRIB3 (Tribbles Homolog 3 (Drosophila) (TRIB3))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TRIB3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- TRIB3 antibody was raised using a synthetic peptide corresponding to a region with amino acids YVLLEPEEGGRAYQALHCPTGTEYTCKVYPVQEALAVLEPYARLPPHKHV
- Top Product
- Discover our top product TRIB3 Primary Antibody
-
anti-Tribbles Homolog 3 (Drosophila) (TRIB3) (AA 56-145) antibody
TRIB3 Reactivity: Human WB, ELISA, IF, RNAi Host: Mouse Monoclonal 1H2 unconjugated
anti-Tribbles Homolog 3 (Drosophila) (TRIB3) (AA 56-145) antibodyTRIB3 Reactivity: Human WB, ELISA, IP Host: Mouse Monoclonal 3D7 unconjugated
anti-Tribbles Homolog 3 (Drosophila) (TRIB3) (AA 15-45), (N-Term) antibodyTRIB3 Reactivity: Human WB, IHC (p) Host: Rabbit Polyclonal RB4069-RB4070 unconjugated
anti-Tribbles Homolog 3 (Drosophila) (TRIB3) (N-Term) antibodyTRIB3 Reactivity: Human WB, ELISA, IHC (p) Host: Rabbit Polyclonal unconjugated
anti-Tribbles Homolog 3 (Drosophila) (TRIB3) (AA 152-325) antibodyTRIB3 Reactivity: Human ELISA, IHC Host: Rabbit Polyclonal unconjugated
anti-Tribbles Homolog 3 (Drosophila) (TRIB3) antibodyTRIB3 Reactivity: Human ELISA, IHC Host: Rabbit Polyclonal unconjugated
anti-Tribbles Homolog 3 (Drosophila) (TRIB3) (C-Term) antibodyTRIB3 Reactivity: Human IHC, IHC (p) Host: Rabbit Polyclonal unconjugated
anti-Tribbles Homolog 3 (Drosophila) (TRIB3) (C-Term) antibodyTRIB3 Reactivity: Human, Mouse WB, ELISA Host: Rabbit Polyclonal unconjugated
anti-Tribbles Homolog 3 (Drosophila) (TRIB3) (AA 201-300) antibodyTRIB3 Reactivity: Human, Rat ELISA, IHC (p), FACS, IF (cc), IF (p), IHC (fro) Host: Rabbit Polyclonal unconjugated
anti-Tribbles Homolog 3 (Drosophila) (TRIB3) (N-Term) antibodyTRIB3 Reactivity: Human WB, ELISA, IHC Host: Rabbit Polyclonal unconjugated
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TRIB3 Blocking Peptide, catalog no. 33R-10278, is also available for use as a blocking control in assays to test for specificity of this TRIB3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRIB3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TRIB3 (Tribbles Homolog 3 (Drosophila) (TRIB3))
- Alternative Name
- TRIB3 (TRIB3 Products)
- Synonyms
- zgc:76966 antibody, TRIB3 antibody, C20orf97 antibody, NIPK antibody, SINK antibody, SKIP3 antibody, TRB3 antibody, Ifld2 antibody, Nipk antibody, TRB-3 antibody, Trb3 antibody, tribbles pseudokinase 3 antibody, trib3 antibody, TRIB3 antibody, Trib3 antibody
- Background
- The protein encoded by this gene is a putative protein kinase that is induced by the transcription factor NF-kappaB. The encoded protein is a negative regulator of NF-kappaB and can also sensitize cells to TNF- and TRAIL-induced apoptosis. In addition, this protein can negatively regulate the cell survival serine-threonine kinase AKT1.
- Molecular Weight
- 39 kDa (MW of target protein)
- Pathways
- Fc-epsilon Receptor Signaling Pathway, EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Regulation of Lipid Metabolism by PPARalpha
-
You are here:
