FBXO42 antibody (Middle Region)

Catalog No. ABIN632175

Product Details anti-FBXO42 Antibody

Target: FBXO42 (F-Box Protein 42 (FBXO42))

Binding Specificity: Middle Region

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FBXO42 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: FBXO42 antibody was raised against the middle region of FBXO42

Purification: Affinity purified

Immunogen: FBXO42 antibody was raised using the middle region of FBXO42 corresponding to a region with amino acids RSMDEAPCVNGRWGTLRPRAQRQTPSGSREGSLSPARGDGSPILNGGSLS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FBXO42 Blocking Peptide, catalog no. 33R-8199, is also available for use as a blocking control in assays to test for specificity of this FBXO42 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXO42 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FBXO42

Target: FBXO42 (F-Box Protein 42 (FBXO42))

Alternative Name: FBXO42 (FBXO42 Products)

Synonyms: Fbx42 antibody, JFK antibody, 6720460I06Rik antibody, mKIAA1332 antibody, zgc:64224 antibody, wu:fj14e08 antibody, MGC84191 antibody, FBXO42 antibody, F-box protein 42 antibody, F-box protein 42 L homeolog antibody, FBXO42 antibody, Fbxo42 antibody, fbxo42 antibody, fbxo42.L antibody

Background: Members of the F-box protein family, such as FBXO42, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1, cullin, and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains.

Molecular Weight: 78 kDa (MW of target protein)