Choline Kinase alpha antibody (Middle Region)
-
- Target See all Choline Kinase alpha (CHKA) Antibodies
- Choline Kinase alpha (CHKA)
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Choline Kinase alpha antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CHKA antibody was raised against the middle region of CHKA
- Purification
- Affinity purified
- Immunogen
- CHKA antibody was raised using the middle region of CHKA corresponding to a region with amino acids LESVMFAILAERSLGPKLYGIFPQGRLEQFIPSRRLDTEELSLPDISAEI
- Top Product
- Discover our top product CHKA Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CHKA Blocking Peptide, catalog no. 33R-4929, is also available for use as a blocking control in assays to test for specificity of this CHKA antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHKA antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Choline Kinase alpha (CHKA)
- Alternative Name
- CHKA (CHKA Products)
- Synonyms
- im:7143625 antibody, wu:fd46h01 antibody, si:dkey-12e7.3 antibody, CHKA antibody, chkb antibody, ATCK1 antibody, CHOLINE KINASE antibody, CK antibody, F14O23.8 antibody, F14O23_8 antibody, choline kinase 1 antibody, CHK antibody, CKI antibody, EK antibody, CK/EK-alpha antibody, Chetk-alpha antibody, Chk antibody, ChoK antibody, EtnK-alpha antibody, CK-R antibody, choline kinase alpha antibody, choline kinase antibody, choline kinase 1 antibody, chka antibody, CHKA antibody, MCYG_00090 antibody, PF14_0020 antibody, CK1 antibody, CNI01400 antibody, Chka antibody
- Background
- The major pathway for the biosynthesis of phosphatidylcholine occurs via the CDP-choline pathway. CHKA is the initial enzyme in the sequence and may play a regulatory role. It also catalyzes the phosphorylation of ethanolamine.
- Molecular Weight
- 50 kDa (MW of target protein)
-