RRAGD antibody (Middle Region)

Catalog No. ABIN632202

Product Details anti-RRAGD Antibody

Target: RRAGD (Ras-Related GTP Binding D (RRAGD))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RRAGD antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RRAGD antibody was raised against the middle region of RRAGD

Purification: Affinity purified

Immunogen: RRAGD antibody was raised using the middle region of RRAGD corresponding to a region with amino acids CDMIDVVIDISCIYGLKEDGAGTPYDKESTAIIKLNNTTVLYLKEVTKFL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RRAGD Blocking Peptide, catalog no. 33R-1669, is also available for use as a blocking control in assays to test for specificity of this RRAGD antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RRAGD antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RRAGD

Target: RRAGD (Ras-Related GTP Binding D (RRAGD))

Alternative Name: RRAGD (RRAGD Products)

Synonyms: RAGD antibody, bA11D8.2.1 antibody, 5730543C08Rik antibody, AI467523 antibody, C030003H22Rik antibody, D4Ertd174e antibody, Ras related GTP binding D antibody, Ras-related GTP binding D antibody, RRAGD antibody, Rragd antibody

Background: RRAGD is a monomeric guanine nucleotide-binding protein, or G protein. By binding GTP or GDP, small G proteins act as molecular switches in numerous cell processes and signaling pathways.

Molecular Weight: 45 kDa (MW of target protein)