TNFAIP8L1 antibody (Middle Region)
-
- Target See all TNFAIP8L1 products
- TNFAIP8L1 (Tumor Necrosis Factor, alpha-Induced Protein 8-Like 1 (TNFAIP8L1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TNFAIP8L1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- TNFAIP8 L1 antibody was raised against the middle region of TNFAIP8 1
- Purification
- Affinity purified
- Immunogen
- TNFAIP8 L1 antibody was raised using the middle region of TNFAIP8 1 corresponding to a region with amino acids AKSHGRINHVFGHLADCDFLAALYGPAEPYRSHLRRICEGLGRMLDEGSL
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TNFAIP8L1 Blocking Peptide, catalog no. 33R-1311, is also available for use as a blocking control in assays to test for specificity of this TNFAIP8L1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TNFAIP0 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TNFAIP8L1 (Tumor Necrosis Factor, alpha-Induced Protein 8-Like 1 (TNFAIP8L1))
- Alternative Name
- TNFAIP8L1 (TNFAIP8L1 Products)
- Synonyms
- TIPE1 antibody, 2600017J23Rik antibody, TNF alpha induced protein 8 like 1 antibody, tumor necrosis factor, alpha-induced protein 8-like 1 antibody, TNFAIP8L1 antibody, Tnfaip8l1 antibody
- Background
- TNFAIP8L1 belongs to the TNFAIP8 family. The exact function of TNFAIP8L is not known.
- Molecular Weight
- 21 kDa (MW of target protein)
-