MYL9 antibody (Middle Region)

Catalog No. ABIN632242

Product Details anti-MYL9 Antibody

Target: MYL9 (Myosin Regulatory Light Chain 2, Smooth Muscle Isoform (MYL9))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MYL9 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: MYL9 antibody was raised against the middle region of MYL9

Purification: Affinity purified

Immunogen: MYL9 antibody was raised using the middle region of MYL9 corresponding to a region with amino acids FDEEASGFIHEDHLRELLTTMGDRFTDEEVDEMYREAPIDKKGNFNYVEF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MYL9 Blocking Peptide, catalog no. 33R-2863, is also available for use as a blocking control in assays to test for specificity of this MYL9 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MYL9 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MYL9

Target: MYL9 (Myosin Regulatory Light Chain 2, Smooth Muscle Isoform (MYL9))

Alternative Name: MYL9 (MYL9 Products)

Synonyms: LC20 antibody, MLC-2C antibody, MLC2 antibody, MRLC1 antibody, MYRL2 antibody, AI327049 antibody, MLC20 antibody, Mylc2c antibody, RLC-C antibody, myosin antibody, regulatory antibody, MRCL3 antibody, MRLC2 antibody, MYL9 antibody, zgc:103467 antibody, myl9 antibody, zgc:77916 antibody, myosin light chain 9 antibody, myosin, light polypeptide 9, regulatory antibody, myosin light chain 9 L homeolog antibody, myosin, light chain 9, regulatory antibody, myosin, light chain 12A, regulatory, non-sarcomeric antibody, myosin, light chain 9a, regulatory antibody, myosin, light chain 9b, regulatory antibody, MYL9 antibody, Myl9 antibody, myl9.L antibody, MYL12A antibody, myl9a antibody, myl9b antibody

Background: Myosin, a structural component of muscle, consists of two heavy chains and four light chains. MYL9 is a myosin light chain that may regulate muscle contraction by modulating the ATPase activity of myosin heads. It binds calcium and is activated by myosin light chain kinase. Two transcript variants encoding different isoforms have been found for this gene. Myosin, a structural component of muscle, consists of two heavy chains and four light chains.

Molecular Weight: 20 kDa (MW of target protein)