EPS8 antibody (Middle Region)

Catalog No. ABIN632256

Product Details anti-EPS8 Antibody

Target: EPS8 (Epidermal Growth Factor Receptor Pathway Substrate 8 (EPS8))

Binding Specificity: Middle Region

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This EPS8 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: EPS8 antibody was raised against the middle region of EPS8

Purification: Affinity purified

Immunogen: EPS8 antibody was raised using the middle region of EPS8 corresponding to a region with amino acids VSKVPANITRQNSSSSDSGGSIVRDSQRHKQLPVDRRKSQMEEVQDELIH

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

EPS8 Blocking Peptide, catalog no. 33R-9810, is also available for use as a blocking control in assays to test for specificity of this EPS8 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EPS8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for EPS8

Target: EPS8 (Epidermal Growth Factor Receptor Pathway Substrate 8 (EPS8))

Alternative Name: EPS8 (EPS8 Products)

Synonyms: AW261790 antibody, MGC81285 antibody, MGC146320 antibody, zgc:56041 antibody, epidermal growth factor receptor pathway substrate 8 antibody, epidermal growth factor receptor pathway substrate 8 L homeolog antibody, EPS8 antibody, Eps8 antibody, eps8.L antibody, eps8 antibody

Background: This gene encodes a member of the EPS8 family. This protein contains one PH domain and one SH3 domain. It functions as part of the EGFR pathway, though its exact role has not been determined.

Molecular Weight: 92 kDa (MW of target protein)

Pathways: EGFR Signaling Pathway, Regulation of Actin Filament Polymerization