NCDN antibody (N-Term)

Catalog No. ABIN632258

Product Details anti-NCDN Antibody

Target: NCDN (Neurochondrin (NCDN))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NCDN antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Neurochondrin antibody was raised against the N terminal of NCDN

Purification: Affinity purified

Immunogen: Neurochondrin antibody was raised using the N terminal of NCDN corresponding to a region with amino acids MSCCDLAAAGQLGKASIMASDCEPALNQAEGRNPTLERYLGALREAKNDS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Neurochondrin Blocking Peptide, catalog no. 33R-6403, is also available for use as a blocking control in assays to test for specificity of this Neurochondrin antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NCDN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NCDN

Target: NCDN (Neurochondrin (NCDN))

Alternative Name: Neurochondrin (NCDN Products)

Synonyms: CG2330 antibody, Dmel\\CG2330 antibody, NCDN antibody, GB14786 antibody, AU042419 antibody, MMS10-AE antibody, Ms10ae antibody, mKIAA0607 antibody, norbin antibody, Norbin antibody, CG2330 gene product from transcript CG2330-RA antibody, neurochondrin antibody, N-acylneuraminate-9-phosphatase antibody, neurochondrin S homeolog antibody, Neurochondrin antibody, NCDN antibody, LOC552430 antibody, ncdn antibody, Ncdn antibody, ncdn.S antibody

Background: This gene encodes a leucine-rich cytoplasmic protein, which is highly similar to a mouse protein that negatively regulates Ca/calmodulin-dependent protein kinase II phosphorylation and may be essential for spatial learning processes.

Molecular Weight: 79 kDa (MW of target protein)