RPS6KB1 antibody (N-Term)

Catalog No. ABIN632265

Product Details anti-RPS6KB1 Antibody

Target: RPS6KB1 (Ribosomal Protein S6 Kinase, 70kDa, Polypeptide 1 (RPS6KB1))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RPS6KB1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RPS6 KB1 antibody was raised against the N terminal of RPS6 B1

Purification: Affinity purified

Immunogen: RPS6 KB1 antibody was raised using the N terminal of RPS6 B1 corresponding to a region with amino acids MRRRRRRDGFYPAPDFRDREAEDMAGVFDIDLDQPEDAGSEDELEEGGQL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RPS6KB1 Blocking Peptide, catalog no. 33R-6382, is also available for use as a blocking control in assays to test for specificity of this RPS6KB1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPS0 B1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RPS6KB1

Target: RPS6KB1 (Ribosomal Protein S6 Kinase, 70kDa, Polypeptide 1 (RPS6KB1))

Alternative Name: RPS6KB1 (RPS6KB1 Products)

Synonyms: PS6K antibody, S6K antibody, S6K-beta-1 antibody, S6K1 antibody, STK14A antibody, p70 S6KA antibody, p70(S6K)-alpha antibody, p70-S6K antibody, p70-alpha antibody, 10539 antibody, 7084 antibody, CG10539 antibody, DS6K antibody, Dmel\\CG10539 antibody, Dp70S6k antibody, Dp70[s6k] antibody, Dp70s6k antibody, S6k antibody, dS6K antibody, dS6k antibody, dp70[S6k] antibody, dp70s6k antibody, dps6k antibody, ds6k antibody, fs(3)07084 antibody, l(3)07084 antibody, p70 S6K antibody, p70/S6K antibody, p70S6K antibody, p70[S6 kinase] antibody, p70[S6K] antibody, p70[S6k] antibody, p70[S6kinase] antibody, p70s6K antibody, s6k antibody, s6k11 antibody, 2610318I15Rik antibody, 4732464A07Rik antibody, 70kDa antibody, AA959758 antibody, AI256796 antibody, AI314060 antibody, p70/85s6k antibody, p70s6k antibody, p70s6k-A antibody, p70-s6k antibody, ps6k antibody, rps6kb1 antibody, rps6kb1-A antibody, s6K1 antibody, stk14a antibody, fc51h01 antibody, wu:fc51h01 antibody, zgc:55713 antibody, ribosomal protein S6 kinase B1 antibody, Ribosomal protein S6 kinase antibody, ribosomal protein S6 kinase, polypeptide 1 antibody, ribosomal protein S6 kinase B1 L homeolog antibody, ribosomal protein S6 kinase B1 S homeolog antibody, ribosomal protein S6 kinase b, polypeptide 1b antibody, RPS6KB1 antibody, S6k antibody, Rps6kb1 antibody, rps6kb1.L antibody, rps6kb1.S antibody, rps6kb1b antibody

Background: This gene encodes a member of the RSK (ribosomal S6 kinase) family of serine/threonine kinases. This kinase contains 2 non-identical kinase catalytic domains and phosphorylates several residues of the S6 ribosomal protein.

Molecular Weight: 59 kDa (MW of target protein)

Pathways: PI3K-Akt Signaling, RTK Signaling, AMPK Signaling, Regulation of Cell Size, Skeletal Muscle Fiber Development, Feeding Behaviour, G-protein mediated Events, Smooth Muscle Cell Migration, Interaction of EGFR with phospholipase C-gamma, Warburg Effect