PRKAB2 antibody (Middle Region)

Catalog No. ABIN632267

Product Details anti-PRKAB2 Antibody

Target: PRKAB2 (Protein Kinase, AMP-Activated, beta 2 Non-Catalytic Subunit (PRKAB2))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PRKAB2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PRKAB2 antibody was raised against the middle region of PRKAB2

Purification: Affinity purified

Immunogen: PRKAB2 antibody was raised using the middle region of PRKAB2 corresponding to a region with amino acids RDLSSSPPGPYGQEMYAFRSEERFKSPPILPPHLLQVILNKDTNISCDPA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PRKAB2 Blocking Peptide, catalog no. 33R-7854, is also available for use as a blocking control in assays to test for specificity of this PRKAB2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRKAB2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PRKAB2

Target: PRKAB2 (Protein Kinase, AMP-Activated, beta 2 Non-Catalytic Subunit (PRKAB2))

Alternative Name: PRKAB2 (PRKAB2 Products)

Synonyms: prkab2 antibody, MGC64365 antibody, PRKAB2 antibody, DKFZp469M1118 antibody, 5730553K21Rik antibody, AW049591 antibody, BB124140 antibody, protein kinase, AMP-activated, beta 2 non-catalytic subunit L homeolog antibody, protein kinase AMP-activated non-catalytic subunit beta 2 antibody, protein kinase, AMP-activated, beta 2 non-catalytic subunit antibody, prkab2.L antibody, PRKAB2 antibody, prkab2 antibody, Prkab2 antibody

Background: The protein encoded by this gene is a regulatory subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits.

Molecular Weight: 30 kDa (MW of target protein)

Pathways: AMPK Signaling, Warburg Effect