GRAP antibody (Middle Region)

Catalog No. ABIN632276

Product Details anti-GRAP Antibody

Target: GRAP (GRB2-Related Adaptor Protein (GRAP))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GRAP antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: GRAP antibody was raised against the middle region of GRAP

Purification: Affinity purified

Immunogen: GRAP antibody was raised using the middle region of GRAP corresponding to a region with amino acids KRQIFLRDEEPLLKSPGACFAQAQFDFSAQDPSQLSFRRGDIIEVLERPD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GRAP Blocking Peptide, catalog no. 33R-4634, is also available for use as a blocking control in assays to test for specificity of this GRAP antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GRAP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GRAP

Target: GRAP (GRB2-Related Adaptor Protein (GRAP))

Alternative Name: GRAP (GRAP Products)

Synonyms: 8430435N19Rik antibody, BB233594 antibody, GRAP antibody, grap antibody, zgc:110202 antibody, MGC109892 antibody, si:dkeyp-9d4.1 antibody, Grap antibody, GRB2-related adaptor protein antibody, GRB2-related adapter protein antibody, GRB2-related adaptor protein a antibody, GRB2-related adaptor protein b antibody, GRAP antibody, Grap antibody, LOC489534 antibody, grapa antibody, grapb antibody, LOC100727005 antibody

Background: This gene encodes a member of the GRB2/Sem5/Drk family. This member functions as a cytoplasmic signaling protein which contains an SH2 domain flanked by two SH3 domains. The SH2 domain interacts with ligand-activated receptors for stem cell factor and erythropoietin, and facilitates the formation of a stable complex with the BCR-ABL oncoprotein. This protein also associates with the Ras guanine nucleotide exchange factor SOS1 (son of sevenless homolog 1) through its N-terminal SH3 domain.

Molecular Weight: 25 kDa (MW of target protein)