ALKBH3 antibody
-
- Target See all ALKBH3 Antibodies
- ALKBH3 (AlkB, Alkylation Repair Homolog 3 (ALKBH3))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ALKBH3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- ALKBH3 antibody was raised using a synthetic peptide corresponding to a region with amino acids EMRKKPPPEENGDYTYVERVKIPLDHGTLLIMEGATQADWQHRVPKEYHS
- Top Product
- Discover our top product ALKBH3 Primary Antibody
-
anti-AlkB, Alkylation Repair Homolog 3 (ALKBH3) (AA 1-170) antibody
ALKBH3 Reactivity: Human ELISA, IHC, IF Host: Rabbit Polyclonal unconjugated
anti-AlkB, Alkylation Repair Homolog 3 (ALKBH3) (AA 1-139) antibodyALKBH3 Reactivity: Human WB, ELISA Host: Mouse Monoclonal 2A5-4F5 unconjugated
anti-AlkB, Alkylation Repair Homolog 3 (ALKBH3) (Internal Region) antibodyALKBH3 Reactivity: Human, Mouse, Rat WB, ELISA, IHC Host: Rabbit Polyclonal unconjugated
anti-AlkB, Alkylation Repair Homolog 3 (ALKBH3) (AA 242-269), (C-Term) antibodyALKBH3 Reactivity: Human, Mouse WB, IHC (p) Host: Rabbit Polyclonal RB22074 unconjugated
anti-AlkB, Alkylation Repair Homolog 3 (ALKBH3) (AA 1-286) antibodyALKBH3 Reactivity: Human WB, IP Host: Rabbit Polyclonal unconjugated
anti-AlkB, Alkylation Repair Homolog 3 (ALKBH3) (AA 216-265) antibodyALKBH3 Reactivity: Human, Mouse, Rat, Horse, Rabbit, Bat, Monkey WB, IHC, IHC (p) Host: Rabbit Polyclonal unconjugated
anti-AlkB, Alkylation Repair Homolog 3 (ALKBH3) (AA 1-286) antibodyALKBH3 Reactivity: Human WB Host: Rabbit Polyclonal unconjugated
anti-AlkB, Alkylation Repair Homolog 3 (ALKBH3) (Middle Region) antibodyALKBH3 Reactivity: Human, Mouse, Rat, Horse, Rabbit, Cow, Dog, Guinea Pig, Pig WB Host: Rabbit Polyclonal unconjugated
anti-AlkB, Alkylation Repair Homolog 3 (ALKBH3) (AA 1-286) antibody (APC)ALKBH3 Reactivity: Human IHC, IF, FACS, ICC Host: Rabbit Polyclonal APC
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ALKBH3 Blocking Peptide, catalog no. 33R-2593, is also available for use as a blocking control in assays to test for specificity of this ALKBH3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALKBH3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ALKBH3 (AlkB, Alkylation Repair Homolog 3 (ALKBH3))
- Alternative Name
- ALKBH3 (ALKBH3 Products)
- Synonyms
- ABH3 antibody, DEPC-1 antibody, DEPC1 antibody, PCA1 antibody, 1700108H04Rik antibody, 1810020C19Rik antibody, Abh3 antibody, mABH3 antibody, alkB homolog 3, alpha-ketoglutarate-dependent dioxygenase L homeolog antibody, alkB homolog 3, alpha-ketoglutaratedependent dioxygenase antibody, alkB homolog 3, alpha-ketoglutarate-dependent dioxygenase antibody, alkbh3.L antibody, ALKBH3 antibody, Alkbh3 antibody
- Background
- The Escherichia coli AlkB protein protects against the cytotoxicity of methylating agents by repair of the specific DNA lesions generated in single-stranded DNA. ALKBH2 and ALKBH3 are E. coli AlkB homologs that catalyze the removal of 1-methyladenine and 3-methylcytosine.
- Molecular Weight
- 33 kDa (MW of target protein)
- Pathways
- DNA Damage Repair
-
