PRMT3 antibody (Middle Region)

Catalog No. ABIN632279

Product Details anti-PRMT3 Antibody

Target: PRMT3 (Protein Arginine Methyltransferase 3 (PRMT3))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PRMT3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PRMT3 antibody was raised against the middle region of PRMT3

Purification: Affinity purified

Immunogen: PRMT3 antibody was raised using the middle region of PRMT3 corresponding to a region with amino acids LEFSSDFTLKITRTSMCTAIAGYFDIYFEKNCHNRVVFSTGPQSTKTHWK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PRMT3 Blocking Peptide, catalog no. 33R-4896, is also available for use as a blocking control in assays to test for specificity of this PRMT3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRMT3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PRMT3

Target: PRMT3 (Protein Arginine Methyltransferase 3 (PRMT3))

Alternative Name: PRMT3 (PRMT3 Products)

Synonyms: HRMT1L3 antibody, 2010005E20Rik antibody, 2410018A17Rik antibody, AL033309 antibody, Hrmt1l3 antibody, PRMT3 antibody, hrmt1l3 antibody, zgc:112498 antibody, ARABIDOPSIS THALIANA PROTEIN ARGININE METHYLTRANSFERASE 3 antibody, ATPRMT3 antibody, protein arginine methyltransferase 3 antibody, protein arginine methyltransferase 3 antibody, protein arginine N-methyltransferase 3 antibody, protein arginine methyltransferase 3 S homeolog antibody, PRMT3 antibody, Prmt3 antibody, prmt3 antibody, prmt3.S antibody

Background: Type I protein arginine N-methyltransferases (PRMTs), such as PRMT3, catalyze the formation of asymmetric N(G),N(G)-dimethylarginine (ADMA) residues in proteins.

Molecular Weight: 60 kDa (MW of target protein)

Pathways: Protein targeting to Nucleus